Lineage for d2xy8b_ (2xy8 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2020013Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily)
    3 helices; irregular array
  4. 2020014Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family) (S)
    automatically mapped to Pfam PF06440
  5. 2020015Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 proteins)
    Pfam PF06440
    independent solution structure determinations of different members resulted in similar secondary structures but different folds
  6. 2020021Protein Theta subunit of DNA polymerase III [46577] (1 species)
  7. 2020022Species Escherichia coli [TaxId:562] [46578] (4 PDB entries)
  8. 2020023Domain d2xy8b_: 2xy8 B: [244621]
    Other proteins in same PDB: d2xy8a_
    automated match to d1du2a_
    protein/DNA complex; complexed with ca

Details for d2xy8b_

PDB Entry: 2xy8 (more details)

PDB Description: paramagnetic-based nmr structure of the complex between the n- terminal epsilon domain and the theta domain of the dna polymerase iii
PDB Compounds: (B:) DNA polymerase III subunit theta

SCOPe Domain Sequences for d2xy8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xy8b_ a.237.1.1 (B:) Theta subunit of DNA polymerase III {Escherichia coli [TaxId: 562]}
qtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahrlasvnlsrl
p

SCOPe Domain Coordinates for d2xy8b_:

Click to download the PDB-style file with coordinates for d2xy8b_.
(The format of our PDB-style files is described here.)

Timeline for d2xy8b_: