SCOPe 2.04: Domain d2xy8b_: 2xy8 B:

Lineage for d2xy8b_ (2xy8 B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family)
   automatically mapped to Pfam PF06440

5. Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 proteins)
   Pfam PF06440
   independent solution structure determinations of different members resulted in similar secondary structures but different folds

6. Protein Theta subunit of DNA polymerase III [46577] (1 species)

7. Species Escherichia coli [TaxId:562] [46578] (4 PDB entries)

8. Domain d2xy8b_: 2xy8 B: [244621]
   Other proteins in same PDB: d2xy8a_
   automated match to d1du2a_
   protein/DNA complex; complexed with ca

Details for d2xy8b_

PDB Entry: 2xy8

PDB Description: paramagnetic-based nmr structure of the complex between the n- terminal epsilon domain and the theta domain of the dna polymerase iii

PDB Compounds: (B:) DNA polymerase III subunit theta

SCOPe Domain Sequences for d2xy8b_:

Sequence; same for both SEQRES and ATOM records:

>d2xy8b_ a.237.1.1 (B:) Theta subunit of DNA polymerase III {Escherichia coli [TaxId: 562]}
qtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahrlasvnlsrl
p

Timeline for d2xy8b_:

• d2xy8b_ is new in SCOPe 2.04-stable
  
• d2xy8b_ appears in SCOPe 2.05
  
• d2xy8b_ appears in the current release, SCOPe 2.08