Class a: All alpha proteins [46456] (285 folds) |
Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily) 3 helices; irregular array |
Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family) automatically mapped to Pfam PF06440 |
Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 proteins) Pfam PF06440 independent solution structure determinations of different members resulted in similar secondary structures but different folds |
Protein Theta subunit of DNA polymerase III [46577] (1 species) |
Species Escherichia coli [TaxId:562] [46578] (4 PDB entries) |
Domain d2xy8b_: 2xy8 B: [244621] Other proteins in same PDB: d2xy8a_ automated match to d1du2a_ protein/DNA complex; complexed with ca |
PDB Entry: 2xy8 (more details)
SCOPe Domain Sequences for d2xy8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xy8b_ a.237.1.1 (B:) Theta subunit of DNA polymerase III {Escherichia coli [TaxId: 562]} qtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahrlasvnlsrl p
Timeline for d2xy8b_: