SCOPe 2.06: Domain d2xy8a_: 2xy8 A:

Lineage for d2xy8a_ (2xy8 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein automated matches [190162] (5 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187263] (14 PDB entries)

8. Domain d2xy8a_: 2xy8 A: [244620]
   Other proteins in same PDB: d2xy8b_
   automated match to d2guia_
   protein/DNA complex; complexed with ca

Details for d2xy8a_

PDB Entry: 2xy8

PDB Description: paramagnetic-based nmr structure of the complex between the n- terminal epsilon domain and the theta domain of the dna polymerase iii

PDB Compounds: (A:) DNA polymerase III subunit epsilon

SCOPe Domain Sequences for d2xy8a_:

Sequence; same for both SEQRES and ATOM records:

>d2xy8a_ c.55.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
rqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdpeafgvh
giadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipktntfck
vtdslavarkmfpgkrnsldalcaryeidnskrtlhgalldaqilaevylamtgg

Timeline for d2xy8a_:

• d2xy8a_ first appeared in SCOPe 2.04
  
• d2xy8a_ appears in SCOPe 2.05
  
• d2xy8a_ appears in SCOPe 2.07
  
• d2xy8a_ appears in the current release, SCOPe 2.08