Lineage for d2xxka1 (2xxk A:1-306)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914680Protein automated matches [190140] (37 species)
    not a true protein
  7. 2914798Species Haemophilus influenzae [TaxId:727] [255670] (6 PDB entries)
  8. 2914801Domain d2xxka1: 2xxk A:1-306 [244613]
    Other proteins in same PDB: d2xxka2
    automated match to d2ceya_
    complexed with slb

Details for d2xxka1

PDB Entry: 2xxk (more details), 1.48 Å

PDB Description: siap complex
PDB Compounds: (A:) Sialic acid-binding periplasmic protein siaP

SCOPe Domain Sequences for d2xxka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xxka1 c.94.1.1 (A:1-306) automated matches {Haemophilus influenzae [TaxId: 727]}
adydlkfgmnagtssneykaaemfakevkeksqgkieislypssqlgddramlkqlkdgs
ldftfaesarfqlfypeaavfalpyvisnynvaqkalfdtefgkdlikkmdkdlgvtlls
qayngtrqttsnrainsiadmkglklrvpdaatnlayakyvgasptpmafsevylalqtn
avdgqenplaavqaqkfyevqkflamtnhilndqlylvsnetykelpedlqkvvkdaaen
aakyhtklfvdgekdlvtffekqgvkithpdlvpfkesmkpyyaefvkqtgqkgesalkq
ieainp

SCOPe Domain Coordinates for d2xxka1:

Click to download the PDB-style file with coordinates for d2xxka1.
(The format of our PDB-style files is described here.)

Timeline for d2xxka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xxka2