| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
| Protein automated matches [226877] (4 species) not a true protein |
| Species Achromobacter xylosoxidans [TaxId:85698] [225099] (11 PDB entries) |
| Domain d2xx1e2: 2xx1 E:160-336 [244610] automated match to d1oe1a2 complexed with cu, no2, so4; mutant |
PDB Entry: 2xx1 (more details), 3 Å
SCOPe Domain Sequences for d2xx1e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xx1e2 b.6.1.3 (E:160-336) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr
Timeline for d2xx1e2: