SCOPe 2.04: Domain d2xx1a2: 2xx1 A:160-336

Lineage for d2xx1a2 (2xx1 A:160-336)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein automated matches [226877] (2 species)
   not a true protein
7. Species Achromobacter xylosoxidans [TaxId:85698] [225099] (9 PDB entries)

8. Domain d2xx1a2: 2xx1 A:160-336 [244602]
   automated match to d1oe1a2
   complexed with cu, no2, so4; mutant

Details for d2xx1a2

PDB Entry: 2xx1, 3 Å

PDB Description: structure of the n90s mutant of nitrite reductase from alcaligenes xylosoxidans complexed with nitrite

PDB Compounds: (A:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d2xx1a2:

Sequence; same for both SEQRES and ATOM records:

>d2xx1a2 b.6.1.3 (A:160-336) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr

Timeline for d2xx1a2:

• d2xx1a2 is new in SCOPe 2.04-stable
  
• d2xx1a2 appears in SCOPe 2.05
  
• d2xx1a2 appears in the current release, SCOPe 2.08