Lineage for d1ckba_ (1ckb A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58264Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 58293Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 58294Family b.34.2.1: SH3-domain [50045] (18 proteins)
  6. 58329Protein C-Crk, N-terminal SH3 domain [50046] (1 species)
  7. 58330Species Mouse (Mus musculus) [TaxId:10090] [50047] (3 PDB entries)
  8. 58332Domain d1ckba_: 1ckb A: [24460]

Details for d1ckba_

PDB Entry: 1ckb (more details), 1.9 Å

PDB Description: structural basis for the specific interaction of lysine-containing proline-rich peptides with the n-terminal sh3 domain of c-crk

SCOP Domain Sequences for d1ckba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ckba_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus)}
aeyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyveky

SCOP Domain Coordinates for d1ckba_:

Click to download the PDB-style file with coordinates for d1ckba_.
(The format of our PDB-style files is described here.)

Timeline for d1ckba_: