Lineage for d2xurb3 (2xur B:245-364)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2583354Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2583355Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2583764Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2583765Protein automated matches [226907] (28 species)
    not a true protein
  7. 2583887Species Escherichia coli [TaxId:562] [255692] (2 PDB entries)
  8. 2583899Domain d2xurb3: 2xur B:245-364 [244590]
    automated match to d4k3lb3
    mutant

Details for d2xurb3

PDB Entry: 2xur (more details), 1.9 Å

PDB Description: the g157c mutation in the escherichia coli sliding clamp specifically affects initiation of replication
PDB Compounds: (B:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d2xurb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xurb3 d.131.1.0 (B:245-364) automated matches {Escherichia coli [TaxId: 562]}
rrvlpknpdkhleagcdllkqafaraailsnekfrgvrlyvsenqlkitannpeqeeaee
ildvtysgaemeigfnvsyvldvlnalkcenvrmmltdsvssvqiedaasqsaayvvmpm

SCOPe Domain Coordinates for d2xurb3:

Click to download the PDB-style file with coordinates for d2xurb3.
(The format of our PDB-style files is described here.)

Timeline for d2xurb3: