Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins) Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain |
Protein automated matches [254553] (2 species) not a true protein |
Species Clostridium perfringens [TaxId:1502] [255690] (1 PDB entry) |
Domain d2xpkb2: 2xpk B:179-495 [244580] Other proteins in same PDB: d2xpka1, d2xpka3, d2xpkb1, d2xpkb3 automated match to d2v5ca2 complexed with z0m |
PDB Entry: 2xpk (more details), 2.4 Å
SCOPe Domain Sequences for d2xpkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xpkb2 c.1.8.10 (B:179-495) automated matches {Clostridium perfringens [TaxId: 1502]} vsargivegfygtpwthqdrldqikfygenklntyiyapkddpyhrekwrepypesemqr mqelinasaenkvdfvfgispgidirfdgdageedfnhlitkaeslydmgvrsfaiywdd iqdksaakhaqvlnrfneefvkakgdvkplitcpteydtgamvsngqpraytrifaetvd psievmwtgpgvvtneiplsdaqlisgiydrnmavwwnypvtdyfkgklalgpmhgldkg lnqyvdfftvnpmehaelskisihtaadyswnmdnydydkawnraidmlygdlaedmkvf anhstrmdnktwaksgr
Timeline for d2xpkb2: