Lineage for d1byma_ (1bym A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783289Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. 1783353Family b.34.1.2: FeoA-like [50041] (5 proteins)
  6. 1783354Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)
  7. 1783355Species Corynebacterium diphtheriae [TaxId:1717] [50043] (18 PDB entries)
    Uniprot P33120
  8. 1783376Domain d1byma_: 1bym A: [24458]

Details for d1byma_

PDB Entry: 1bym (more details)

PDB Description: solution structures of the c-terminal domain of diphtheria toxin repressor
PDB Compounds: (A:) protein (diphtheria toxin repressor)

SCOPe Domain Sequences for d1byma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byma_ b.34.1.2 (A:) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
npipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqftqlldadirv
gseveivdrdghitlshngkdvellddlahtirieel

SCOPe Domain Coordinates for d1byma_:

Click to download the PDB-style file with coordinates for d1byma_.
(The format of our PDB-style files is described here.)

Timeline for d1byma_: