Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) the N-terminal domains of these repressors bind DNA |
Family b.34.1.2: FeoA-like [50041] (5 proteins) |
Protein Diphtheria toxin repressor (DtxR) [50042] (1 species) |
Species Corynebacterium diphtheriae [TaxId:1717] [50043] (18 PDB entries) Uniprot P33120 |
Domain d1byma_: 1bym A: [24458] |
PDB Entry: 1bym (more details)
SCOPe Domain Sequences for d1byma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1byma_ b.34.1.2 (A:) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} npipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqftqlldadirv gseveivdrdghitlshngkdvellddlahtirieel
Timeline for d1byma_: