SCOP 1.55: Domain d1byma_: 1bym A:

Lineage for d1byma_ (1bym A:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.34: SH3-like barrel [50036] (7 superfamilies)

4. Superfamily b.34.1: C-terminal domain of biotin and diphtheria toxin repressors [50037] (2 families)

5. Family b.34.1.2: Diphtheria toxin repressor (DtxR) [50041] (1 protein)

6. Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [50043] (7 PDB entries)

8. Domain d1byma_: 1bym A: [24458]

Details for d1byma_

PDB Entry: 1bym

PDB Description: solution structures of the c-terminal domain of diphtheria toxin repressor

SCOP Domain Sequences for d1byma_:

Sequence; same for both SEQRES and ATOM records:

>d1byma_ b.34.1.2 (A:) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
npipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqftqlldadirv
gseveivdrdghitlshngkdvellddlahtirieel

Timeline for d1byma_:

• d1byma_ appears in SCOP 1.57
  
• d1byma_ appears in the current release, SCOPe 2.08