SCOPe 2.08: Domain d2xpkb1: 2xpk B:40-178

Lineage for d2xpkb1 (2xpk B:40-178)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.0: automated matches [227269] (1 protein)
   not a true family

6. Protein automated matches [227062] (5 species)
   not a true protein

7. Species Clostridium perfringens [TaxId:1502] [255689] (3 PDB entries)

8. Domain d2xpkb1: 2xpk B:40-178 [244579]
   Other proteins in same PDB: d2xpka2, d2xpka3, d2xpkb2, d2xpkb3
   automated match to d2v5ca1
   complexed with z0m

Details for d2xpkb1

PDB Entry: 2xpk, 2.4 Å

PDB Description: cell-penetrant, nanomolar o-glcnacase inhibitors selective against lysosomal hexosaminidases

PDB Compounds: (B:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d2xpkb1:

Sequence; same for both SEQRES and ATOM records:

>d2xpkb1 d.92.2.0 (B:40-178) automated matches {Clostridium perfringens [TaxId: 1502]}
qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp
nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf
kqlvkesnipevnitdypt

Timeline for d2xpkb1:

• d2xpkb1 first appeared in SCOPe 2.04
  
• d2xpkb1 appears in SCOPe 2.07