![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins) Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain |
![]() | Protein automated matches [254553] (3 species) not a true protein |
![]() | Species Clostridium perfringens [TaxId:1502] [255690] (2 PDB entries) |
![]() | Domain d2xpka2: 2xpk A:179-495 [244577] Other proteins in same PDB: d2xpka1, d2xpka3, d2xpkb1, d2xpkb3 automated match to d2v5ca2 complexed with z0m |
PDB Entry: 2xpk (more details), 2.4 Å
SCOPe Domain Sequences for d2xpka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xpka2 c.1.8.10 (A:179-495) automated matches {Clostridium perfringens [TaxId: 1502]} vsargivegfygtpwthqdrldqikfygenklntyiyapkddpyhrekwrepypesemqr mqelinasaenkvdfvfgispgidirfdgdageedfnhlitkaeslydmgvrsfaiywdd iqdksaakhaqvlnrfneefvkakgdvkplitcpteydtgamvsngqpraytrifaetvd psievmwtgpgvvtneiplsdaqlisgiydrnmavwwnypvtdyfkgklalgpmhgldkg lnqyvdfftvnpmehaelskisihtaadyswnmdnydydkawnraidmlygdlaedmkvf anhstrmdnktwaksgr
Timeline for d2xpka2: