Lineage for d2xpdd_ (2xpd D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2135204Species Yersinia pseudotuberculosis [TaxId:502800] [255688] (4 PDB entries)
  8. 2135210Domain d2xpdd_: 2xpd D: [244571]
    Other proteins in same PDB: d2xpdc2
    automated match to d3p7xa_
    complexed with dtu

Details for d2xpdd_

PDB Entry: 2xpd (more details), 2 Å

PDB Description: Reduced Thiol peroxidase (Tpx) from yersinia Pseudotuberculosis
PDB Compounds: (D:) Thiol Peroxidase

SCOPe Domain Sequences for d2xpdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xpdd_ c.47.1.0 (D:) automated matches {Yersinia pseudotuberculosis [TaxId: 502800]}
mtqtvhfqgnpvsvagklpqigdkakdftlvakdlsdvalssfagkrkvlnifpsidtgv
caasvrkfnqlagelentvvlcissdlpfaqsrfcgaeglsnvitlstlrgadfkqaygv
aitegplagltaravvvldgqdnviyselvneittepnydaalaalk

SCOPe Domain Coordinates for d2xpdd_:

Click to download the PDB-style file with coordinates for d2xpdd_.
(The format of our PDB-style files is described here.)

Timeline for d2xpdd_: