SCOPe 2.04: Domain d2xpdc_: 2xpd C:

Lineage for d2xpdc_ (2xpd C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (133 species)
   not a true protein

7. Species Yersinia pseudotuberculosis [TaxId:502800] [255688] (4 PDB entries)

8. Domain d2xpdc_: 2xpd C: [244570]
   automated match to d3p7xa_
   complexed with dtu

Details for d2xpdc_

PDB Entry: 2xpd, 2 Å

PDB Description: Reduced Thiol peroxidase (Tpx) from yersinia Pseudotuberculosis

PDB Compounds: (C:) Thiol Peroxidase

SCOPe Domain Sequences for d2xpdc_:

Sequence; same for both SEQRES and ATOM records:

>d2xpdc_ c.47.1.0 (C:) automated matches {Yersinia pseudotuberculosis [TaxId: 502800]}
pftmtqtvhfqgnpvsvagklpqigdkakdftlvakdlsdvalssfagkrkvlnifpsid
tgvcaasvrkfnqlagelentvvlcissdlpfaqsrfcgaeglsnvitlstlrgadfkqa
ygvaitegplagltaravvvldgqdnviyselvneittepnydaalaalk

Timeline for d2xpdc_:

• d2xpdc_ is new in SCOPe 2.04-stable
  
• d2xpdc_ appears in SCOPe 2.05
  
• d2xpdc_ appears in the current release, SCOPe 2.08, called d2xpdc1