Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (133 species) not a true protein |
Species Yersinia pseudotuberculosis [TaxId:502800] [255688] (4 PDB entries) |
Domain d2xpdc_: 2xpd C: [244570] automated match to d3p7xa_ complexed with dtu |
PDB Entry: 2xpd (more details), 2 Å
SCOPe Domain Sequences for d2xpdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xpdc_ c.47.1.0 (C:) automated matches {Yersinia pseudotuberculosis [TaxId: 502800]} pftmtqtvhfqgnpvsvagklpqigdkakdftlvakdlsdvalssfagkrkvlnifpsid tgvcaasvrkfnqlagelentvvlcissdlpfaqsrfcgaeglsnvitlstlrgadfkqa ygvaitegplagltaravvvldgqdnviyselvneittepnydaalaalk
Timeline for d2xpdc_: