SCOPe 2.07: Domain d2xpca1: 2xpc A:1-93

Lineage for d2xpca1 (2xpc A:1-93)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group

4. Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families)

5. Family c.5.1.0: automated matches [254240] (1 protein)
   not a true family

6. Protein automated matches [254548] (7 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255257] (8 PDB entries)

8. Domain d2xpca1: 2xpc A:1-93 [244565]
   Other proteins in same PDB: d2xpca2, d2xpca3, d2xpca4
   automated match to d4uaga1
   complexed with 051, cl, dms, so4

Details for d2xpca1

PDB Entry: 2xpc, 1.49 Å

PDB Description: second-generation sulfonamide inhibitors of murd: activity optimisation with conformationally rigid analogues of d-glutamic acid

PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2xpca1:

Sequence; same for both SEQRES and ATOM records:

>d2xpca1 c.5.1.0 (A:1-93) automated matches {Escherichia coli [TaxId: 562]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

Timeline for d2xpca1:

• d2xpca1 first appeared in SCOPe 2.04
  
• d2xpca1 appears in SCOPe 2.06
  
• d2xpca1 appears in the current release, SCOPe 2.08