Lineage for d2xokg_ (2xok G:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1603561Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 1603709Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 1603740Family c.49.2.0: automated matches [191450] (1 protein)
    not a true family
  6. 1603741Protein automated matches [190687] (2 species)
    not a true protein
  7. 1603744Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187815] (6 PDB entries)
  8. 1603757Domain d2xokg_: 2xok G: [244564]
    Other proteins in same PDB: d2xokd1, d2xokd2, d2xokd3, d2xoke1, d2xoke2, d2xoke3, d2xokf1, d2xokf2, d2xokf3
    automated match to d2v7qg_
    complexed with anp, mg

Details for d2xokg_

PDB Entry: 2xok (more details), 3.01 Å

PDB Description: refined structure of yeast f1c10 atpase complex to 3 a resolution
PDB Compounds: (G:) ATP synthase subunit gamma, mitochondrial

SCOPe Domain Sequences for d2xokg_:

Sequence, based on SEQRES records: (download)

>d2xokg_ c.49.2.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
sknagdminrysilynrtrqavitnelvdiitgassl

Sequence, based on observed residues (ATOM records): (download)

>d2xokg_ c.49.2.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknk
elivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllrthpnniklsin
gigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsekpifnaktieqs
psfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdnasknagdminry
silynrtrqavitnelvdiitgassl

SCOPe Domain Coordinates for d2xokg_:

Click to download the PDB-style file with coordinates for d2xokg_.
(The format of our PDB-style files is described here.)

Timeline for d2xokg_: