Lineage for d2xokf3 (2xok F:358-476)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1494900Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 1494901Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families) (S)
  5. 1495029Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 1495030Protein automated matches [254528] (6 species)
    not a true protein
  7. 1495038Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255214] (6 PDB entries)
  8. 1495083Domain d2xokf3: 2xok F:358-476 [244563]
    Other proteins in same PDB: d2xokd1, d2xokd2, d2xoke1, d2xoke2, d2xokf1, d2xokf2, d2xokg_
    automated match to d2jdid1
    complexed with anp, mg

Details for d2xokf3

PDB Entry: 2xok (more details), 3.01 Å

PDB Description: refined structure of yeast f1c10 atpase complex to 3 a resolution
PDB Compounds: (F:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d2xokf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xokf3 a.69.1.0 (F:358-476) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp
favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaae

SCOPe Domain Coordinates for d2xokf3:

Click to download the PDB-style file with coordinates for d2xokf3.
(The format of our PDB-style files is described here.)

Timeline for d2xokf3: