Lineage for d2xokf2 (2xok F:83-357)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1596277Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1596728Protein automated matches [190393] (9 species)
    not a true protein
  7. 1596733Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255213] (6 PDB entries)
  8. 1596778Domain d2xokf2: 2xok F:83-357 [244562]
    Other proteins in same PDB: d2xokd1, d2xokd3, d2xoke1, d2xoke3, d2xokf1, d2xokf3, d2xokg_
    automated match to d2jdid3
    complexed with anp, mg

Details for d2xokf2

PDB Entry: 2xok (more details), 3.01 Å

PDB Description: refined structure of yeast f1c10 atpase complex to 3 a resolution
PDB Compounds: (F:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d2xokf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xokf2 c.37.1.11 (F:83-357) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
isvpvgretlgriinvigepidergpiksklrkpihadppsfaeqstsaeiletgikvvd
llapyarggkiglfggagvgktvfiqelinniakahggfsvftgvgertregndlyremk
etgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdeegqdvllfidnifrft
qagsevsallgripsavgyqptlatdmgllqeritttkkgsvtsvqavyvpaddltdpap
attfahldattvlsrgiselgiypavdpldsksrl

SCOPe Domain Coordinates for d2xokf2:

Click to download the PDB-style file with coordinates for d2xokf2.
(The format of our PDB-style files is described here.)

Timeline for d2xokf2: