SCOPe 2.04: Domain d2xmlb_: 2xml B:

Lineage for d2xmlb_ (2xml B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.14: Histone demethylase core [254153] (4 proteins)
   Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801

6. Protein automated matches [254635] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255633] (3 PDB entries)

8. Domain d2xmlb_: 2xml B: [244539]
   automated match to d2gp5a_
   complexed with cl, edo, ni, oga, zn

Details for d2xmlb_

PDB Entry: 2xml, 2.55 Å

PDB Description: crystal structure of human jmjd2c catalytic domain

PDB Compounds: (B:) lysine-specific demethylase 4c

SCOPe Domain Sequences for d2xmlb_:

Sequence; same for both SEQRES and ATOM records:

>d2xmlb_ b.82.2.14 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnpsckimtfrpsmeefrefnkylaymeskgahraglakvippkewkprqcyddidnlli
papiqqmvtgqsglftqyniqkkamtvkefrqlansgkyctpryldyedlerkywknltf
vapiygadingsiydegvdewniarlntvldvveeecgisiegvntpylyfgmwkttfaw
htedmdlysinylhfgepkswyaippehgkrlerlaqgffpsssqgcdaflrhkmtlisp
svlkkygipfdkitqeagefmitfpygyhagfnhgfncaestnfatvrwidygkvaklct
crkdmvkismdifvrkfqpdryqlwkqgkdiytidhtk

Timeline for d2xmlb_:

• d2xmlb_ is new in SCOPe 2.04-stable
  
• d2xmlb_ appears in SCOPe 2.05
  
• d2xmlb_ appears in the current release, SCOPe 2.08