Lineage for d2xmla_ (2xml A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1807787Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 1808092Family b.82.2.14: Histone demethylase core [254153] (4 proteins)
    Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801
  6. 1808154Protein automated matches [254635] (1 species)
    not a true protein
  7. 1808155Species Human (Homo sapiens) [TaxId:9606] [255633] (14 PDB entries)
  8. 1808166Domain d2xmla_: 2xml A: [244538]
    automated match to d2gp5a_
    complexed with cl, edo, ni, oga, zn

Details for d2xmla_

PDB Entry: 2xml (more details), 2.55 Å

PDB Description: crystal structure of human jmjd2c catalytic domain
PDB Compounds: (A:) lysine-specific demethylase 4c

SCOPe Domain Sequences for d2xmla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xmla_ b.82.2.14 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnpsckimtfrpsmeefrefnkylaymeskgahraglakvippkewkprqcyddidnlli
papiqqmvtgqsglftqyniqkkamtvkefrqlansgkyctpryldyedlerkywknltf
vapiygadingsiydegvdewniarlntvldvveeecgisiegvntpylyfgmwkttfaw
htedmdlysinylhfgepkswyaippehgkrlerlaqgffpsssqgcdaflrhkmtlisp
svlkkygipfdkitqeagefmitfpygyhagfnhgfncaestnfatvrwidygkvaklct
crkdmvkismdifvrkfqpdryqlwkqgkdiytidhtk

SCOPe Domain Coordinates for d2xmla_:

Click to download the PDB-style file with coordinates for d2xmla_.
(The format of our PDB-style files is described here.)

Timeline for d2xmla_: