| Class b: All beta proteins [48724] (180 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
| Family b.82.2.14: Jumonji domain / Histone demethylase core [254153] (7 proteins) Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801 Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801; some members include C-terminal helical subdomain (Pfam PF17811) |
| Protein automated matches [254635] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255633] (100 PDB entries) |
| Domain d2xmla_: 2xml A: [244538] automated match to d2gp5a_ complexed with cl, edo, ni, oga, zn |
PDB Entry: 2xml (more details), 2.55 Å
SCOPe Domain Sequences for d2xmla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xmla_ b.82.2.14 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnpsckimtfrpsmeefrefnkylaymeskgahraglakvippkewkprqcyddidnlli
papiqqmvtgqsglftqyniqkkamtvkefrqlansgkyctpryldyedlerkywknltf
vapiygadingsiydegvdewniarlntvldvveeecgisiegvntpylyfgmwkttfaw
htedmdlysinylhfgepkswyaippehgkrlerlaqgffpsssqgcdaflrhkmtlisp
svlkkygipfdkitqeagefmitfpygyhagfnhgfncaestnfatvrwidygkvaklct
crkdmvkismdifvrkfqpdryqlwkqgkdiytidhtk
Timeline for d2xmla_: