SCOPe 2.06: Domain d2xk5b_: 2xk5 B:

Lineage for d2xk5b_ (2xk5 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (94 PDB entries)

8. Domain d2xk5b_: 2xk5 B: [244534]
   automated match to d4auqc_
   complexed with zn

Details for d2xk5b_

PDB Entry: 2xk5, 3 Å

PDB Description: crystal structure of k6-linked diubiquitin

PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d2xk5b_:

Sequence; same for both SEQRES and ATOM records:

>d2xk5b_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtienvkakiqdkegippqqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrg

Timeline for d2xk5b_:

• d2xk5b_ first appeared in SCOPe 2.04
  
• d2xk5b_ appears in SCOPe 2.05
  
• d2xk5b_ appears in SCOPe 2.07
  
• d2xk5b_ appears in the current release, SCOPe 2.08