Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189560] (79 PDB entries) |
Domain d2xk5a_: 2xk5 A: [244533] automated match to d4auqc_ complexed with zn |
PDB Entry: 2xk5 (more details), 3 Å
SCOPe Domain Sequences for d2xk5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xk5a_ d.15.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrl
Timeline for d2xk5a_: