Lineage for d2xjxa_ (2xjx A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1667394Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1667395Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1667396Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 1667572Protein automated matches [190229] (8 species)
    not a true protein
  7. 1667585Species Human (Homo sapiens) [TaxId:9606] [187292] (101 PDB entries)
  8. 1667610Domain d2xjxa_: 2xjx A: [244531]
    automated match to d4egia_
    complexed with xjx

Details for d2xjxa_

PDB Entry: 2xjx (more details), 1.66 Å

PDB Description: Structure of HSP90 with small molecule inhibitor bound
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d2xjxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xjxa_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskl
dsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadism
igqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhl
kedqteyleerrikeivkkhsqfigypitlfvekerdkevs

SCOPe Domain Coordinates for d2xjxa_:

Click to download the PDB-style file with coordinates for d2xjxa_.
(The format of our PDB-style files is described here.)

Timeline for d2xjxa_: