Lineage for d2xjva1 (2xjv A:23-271)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2089592Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 2089593Superfamily b.179.1: PA14-like [254123] (3 families) (S)
  5. 2089635Family b.179.1.2: GLEYA domain [254187] (2 proteins)
    Pfam PF10528
    PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges
  6. 2089636Protein GLEYA domain [254411] (1 species)
    PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges
  7. 2089637Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [254850] (7 PDB entries)
  8. 2089644Domain d2xjva1: 2xjv A:23-271 [244530]
    Other proteins in same PDB: d2xjva2
    automated match to d2xjra_
    complexed with bgc, ca, cl, na; mutant

Details for d2xjva1

PDB Entry: 2xjv (more details), 1.74 Å

PDB Description: x-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae with mutation d201t in complex with calcium and glucose
PDB Compounds: (A:) flocculation protein flo5

SCOPe Domain Sequences for d2xjva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xjva1 b.179.1.2 (A:23-271) GLEYA domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sgateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsvggqtdisid
ynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttptnvtlemtg
yflppqtgsytfsfatvddsailsvggsiafeccaqeqppitstnftingikpwdgslpt
nitgtvymyagyyyplkvvysnavswgtlpisvelpdgttvsdnfegyvysfdddlsqsn
ctipdpsih

SCOPe Domain Coordinates for d2xjva1:

Click to download the PDB-style file with coordinates for d2xjva1.
(The format of our PDB-style files is described here.)

Timeline for d2xjva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xjva2