Lineage for d2xjua_ (2xju A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1565881Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 1565882Superfamily b.179.1: PA14-like [254123] (3 families) (S)
  5. 1565923Family b.179.1.2: GLEYA domain [254187] (2 proteins)
    Pfam PF10528
    PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges
  6. 1565924Protein GLEYA domain [254411] (1 species)
    PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges
  7. 1565925Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [254850] (7 PDB entries)
  8. 1565931Domain d2xjua_: 2xju A: [244529]
    automated match to d2xjra_
    complexed with ca, cl, gol, na; mutant

Details for d2xjua_

PDB Entry: 2xju (more details), 1.7 Å

PDB Description: x-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae with mutation s227a in complex with calcium and a1,2-mannobiose
PDB Compounds: (A:) flocculation protein flo5

SCOPe Domain Sequences for d2xjua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xjua_ b.179.1.2 (A:) GLEYA domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
glvprgshmsgateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsv
ggqtdisidynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttp
tnvtlemtgyflppqtgsytfsfatvddsailsvggsiafeccaqeqppitstnftingi
kpwdgslpdnitgtvymyagyyyplkvvysnavawgtlpisvelpdgttvsdnfegyvys
fdddlsqsnctipdpsih

SCOPe Domain Coordinates for d2xjua_:

Click to download the PDB-style file with coordinates for d2xjua_.
(The format of our PDB-style files is described here.)

Timeline for d2xjua_: