SCOPe 2.07: Domain d2xjsa1: 2xjs A:23-271

Lineage for d2xjsa1 (2xjs A:23-271)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
   core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains

4. Superfamily b.179.1: PA14-like [254123] (3 families)

5. Family b.179.1.2: GLEYA domain [254187] (2 proteins)
   Pfam PF10528
   PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges

6. Protein GLEYA domain [254411] (1 species)
   PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [254850] (7 PDB entries)

8. Domain d2xjsa1: 2xjs A:23-271 [244527]
   Other proteins in same PDB: d2xjsa2
   automated match to d2xjra_
   complexed with ca, cl, na

Details for d2xjsa1

PDB Entry: 2xjs, 1.3 Å

PDB Description: x-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae in complex with calcium and a1,2-mannobiose

PDB Compounds: (A:) flocculation protein flo5

SCOPe Domain Sequences for d2xjsa1:

Sequence; same for both SEQRES and ATOM records:

>d2xjsa1 b.179.1.2 (A:23-271) GLEYA domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sgateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsvggqtdisid
ynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttptnvtlemtg
yflppqtgsytfsfatvddsailsvggsiafeccaqeqppitstnftingikpwdgslpd
nitgtvymyagyyyplkvvysnavswgtlpisvelpdgttvsdnfegyvysfdddlsqsn
ctipdpsih

Timeline for d2xjsa1:

• d2xjsa1 first appeared in SCOPe 2.04, called d2xjsa_
  
• d2xjsa1 appears in SCOPe 2.06
  
• d2xjsa1 appears in the current release, SCOPe 2.08