![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily) core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains |
![]() | Superfamily b.179.1: PA14-like [254123] (3 families) ![]() |
![]() | Family b.179.1.2: GLEYA domain [254187] (2 proteins) Pfam PF10528 PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges |
![]() | Protein GLEYA domain [254411] (1 species) PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [254850] (7 PDB entries) |
![]() | Domain d2xjqa1: 2xjq A:23-271 [244525] Other proteins in same PDB: d2xjqa2 automated match to d2xjra_ complexed with cl, gol, na |
PDB Entry: 2xjq (more details), 1.35 Å
SCOPe Domain Sequences for d2xjqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xjqa1 b.179.1.2 (A:23-271) GLEYA domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} sgateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsvggqtdisid ynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttptnvtlemtg yflppqtgsytfsfatvddsailsvggsiafeccaqeqppitstnftingikpwdgslpd nitgtvymyagyyyplkvvysnavswgtlpisvelpdgttvsdnfegyvysfdddlsqsn ctipdpsih
Timeline for d2xjqa1: