SCOPe 2.04: Domain d2xjpa_: 2xjp A:

Lineage for d2xjpa_ (2xjp A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
   core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains

4. Superfamily b.179.1: PA14-like [254123] (3 families)

5. Family b.179.1.2: GLEYA domain [254187] (2 proteins)
   Pfam PF10528
   PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges

6. Protein GLEYA domain [254411] (1 species)
   PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [254850] (7 PDB entries)

8. Domain d2xjpa_: 2xjp A: [244524]
   automated match to d2xjra_
   complexed with bma, ca, cl, man, na

Details for d2xjpa_

PDB Entry: 2xjp, 0.95 Å

PDB Description: x-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae in complex with calcium and mannose

PDB Compounds: (A:) flocculation protein flo5

SCOPe Domain Sequences for d2xjpa_:

Sequence; same for both SEQRES and ATOM records:

>d2xjpa_ b.179.1.2 (A:) GLEYA domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
glvprgshmsgateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsv
ggqtdisidynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttp
tnvtlemtgyflppqtgsytfsfatvddsailsvggsiafeccaqeqppitstnftingi
kpwdgslpdnitgtvymyagyyyplkvvysnavswgtlpisvelpdgttvsdnfegyvys
fdddlsqsnctipdpsih

Timeline for d2xjpa_:

• d2xjpa_ is new in SCOPe 2.04-stable
  
• d2xjpa_ appears in SCOPe 2.05
  
• d2xjpa_ appears in the current release, SCOPe 2.08, called d2xjpa1