SCOPe 2.04: Domain d2xhnb2: 2xhn B:251-337

Lineage for d2xhnb2 (2xhn B:251-337)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (4 families)

5. Family b.3.1.0: automated matches [254199] (1 protein)
   not a true family

6. Protein automated matches [254436] (4 species)
   not a true protein

7. Species Fungus (Aspergillus aculeatus) [TaxId:5053] [255686] (1 PDB entry)

8. Domain d2xhnb2: 2xhn B:251-337 [244515]
   Other proteins in same PDB: d2xhna1, d2xhna3, d2xhnb1, d2xhnb3
   automated match to d1nkga1
   complexed with ca, edo, so4; mutant

Details for d2xhnb2

PDB Entry: 2xhn, 1.52 Å

PDB Description: rhamnogalacturonan lyase from aspergillus aculeatus k150a active site mutant

PDB Compounds: (B:) Rhamnogalacturonase B

SCOPe Domain Sequences for d2xhnb2:

Sequence; same for both SEQRES and ATOM records:

>d2xhnb2 b.3.1.0 (B:251-337) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
yvaasgrgkvagtasgadssmdwvvhwyndaaqywtytsssgsftspamkpgtytmvyyq
geyavatssvtvsagstttknisgsvk

Timeline for d2xhnb2:

• d2xhnb2 is new in SCOPe 2.04-stable
  
• d2xhnb2 appears in SCOPe 2.05
  
• d2xhnb2 appears in the current release, SCOPe 2.08