SCOPe 2.05: Domain d2xhnb1: 2xhn B:1-250

Lineage for d2xhnb1 (2xhn B:1-250)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.10: Rhamnogalacturonase B, RhgB, N-terminal domain [110151] (2 proteins)
   automatically mapped to Pfam PF09284

6. Protein automated matches [254651] (1 species)
   not a true protein

7. Species Fungus (Aspergillus aculeatus) [TaxId:5053] [255685] (1 PDB entry)

8. Domain d2xhnb1: 2xhn B:1-250 [244514]
   Other proteins in same PDB: d2xhna2, d2xhna3, d2xhnb2, d2xhnb3
   automated match to d1nkga3
   complexed with ca, edo, so4; mutant

Details for d2xhnb1

PDB Entry: 2xhn, 1.52 Å

PDB Description: rhamnogalacturonan lyase from aspergillus aculeatus k150a active site mutant

PDB Compounds: (B:) Rhamnogalacturonase B

SCOPe Domain Sequences for d2xhnb1:

Sequence; same for both SEQRES and ATOM records:

>d2xhnb1 b.30.5.10 (B:1-250) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
afgittsssayvidtnapnqlkftvsrsscditsiihygtelqyssqgshigsglgsatv
tatqsgdyikvtcvtdtltqymvvhngdpiihmatyitaepsigelrfiarlnsdllpne
epfgdvsttadgtaiegsdvflvgsetrsafysserfiddqrhciagdahrvcmilnqye
sssggpfhrdinsnnggsynalywymnsghvqtesyrmglhgpysmyfsrsgtpstsidt
sffadldikg

Timeline for d2xhnb1:

• d2xhnb1 first appeared in SCOPe 2.04
  
• d2xhnb1 appears in SCOPe 2.06
  
• d2xhnb1 appears in the current release, SCOPe 2.08