Lineage for d2xgpb2 (2xgp B:390-510)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614248Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 2614249Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 2614349Family d.240.1.0: automated matches [231323] (1 protein)
    not a true family
  6. 2614350Protein automated matches [231324] (5 species)
    not a true protein
  7. 2614351Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [231491] (7 PDB entries)
  8. 2614360Domain d2xgpb2: 2xgp B:390-510 [244506]
    Other proteins in same PDB: d2xgpa1, d2xgpa3, d2xgpb1, d2xgpb3
    automated match to d2wtfa2
    protein/DNA complex; complexed with ca

Details for d2xgpb2

PDB Entry: 2xgp (more details), 2.7 Å

PDB Description: yeast dna polymerase eta in complex with c8-2-acetylaminofluorene containing dna
PDB Compounds: (B:) DNA Polymerase ETA

SCOPe Domain Sequences for d2xgpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xgpb2 d.240.1.0 (B:390-510) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pvvksmmsnknlrgkscnsivdciswlevfcaeltsriqdleqeynkiviprtvsislkt
ksyevyrksgpvaykginfqshellkvgikfvtdldikgknksyypltklsmtitnfdii
d

SCOPe Domain Coordinates for d2xgpb2:

Click to download the PDB-style file with coordinates for d2xgpb2.
(The format of our PDB-style files is described here.)

Timeline for d2xgpb2: