Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily) beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology |
Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) |
Family d.240.1.0: automated matches [231323] (1 protein) not a true family |
Protein automated matches [231324] (5 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [231491] (7 PDB entries) |
Domain d2xgpb2: 2xgp B:390-510 [244506] Other proteins in same PDB: d2xgpa1, d2xgpa3, d2xgpb1, d2xgpb3 automated match to d2wtfa2 protein/DNA complex; complexed with ca |
PDB Entry: 2xgp (more details), 2.7 Å
SCOPe Domain Sequences for d2xgpb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xgpb2 d.240.1.0 (B:390-510) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pvvksmmsnknlrgkscnsivdciswlevfcaeltsriqdleqeynkiviprtvsislkt ksyevyrksgpvaykginfqshellkvgikfvtdldikgknksyypltklsmtitnfdii d
Timeline for d2xgpb2: