SCOPe 2.08: Domain d2xgpa1: 2xgp A:1-389

Lineage for d2xgpa1 (2xgp A:1-389)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
   contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [231300] (5 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [231489] (6 PDB entries)

8. Domain d2xgpa1: 2xgp A:1-389 [244503]
   Other proteins in same PDB: d2xgpa2, d2xgpa3, d2xgpb2, d2xgpb3
   automated match to d2wtfa1
   protein/DNA complex; complexed with ca

Details for d2xgpa1

PDB Entry: 2xgp, 2.7 Å

PDB Description: yeast dna polymerase eta in complex with c8-2-acetylaminofluorene containing dna

PDB Compounds: (A:) DNA Polymerase ETA

SCOPe Domain Sequences for d2xgpa1:

Sequence; same for both SEQRES and ATOM records:

>d2xgpa1 e.8.1.7 (A:1-389) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwnsii
avsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpakqis
vedhkvslepyrresrkalkifksacdlverasidevfldlgricfnmlmfdneyeltgd
lklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvilal
gsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldcgkf
eitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydrsts
nidplktadlaeklfklsrgryglplssr

Timeline for d2xgpa1:

• d2xgpa1 first appeared in SCOPe 2.04
  
• d2xgpa1 appears in SCOPe 2.07