Lineage for d2xgpa1 (2xgp A:1-389)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3018090Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3018195Protein automated matches [231300] (5 species)
    not a true protein
  7. 3018196Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [231489] (6 PDB entries)
  8. 3018202Domain d2xgpa1: 2xgp A:1-389 [244503]
    Other proteins in same PDB: d2xgpa2, d2xgpa3, d2xgpb2, d2xgpb3
    automated match to d2wtfa1
    protein/DNA complex; complexed with ca

Details for d2xgpa1

PDB Entry: 2xgp (more details), 2.7 Å

PDB Description: yeast dna polymerase eta in complex with c8-2-acetylaminofluorene containing dna
PDB Compounds: (A:) DNA Polymerase ETA

SCOPe Domain Sequences for d2xgpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xgpa1 e.8.1.7 (A:1-389) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwnsii
avsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpakqis
vedhkvslepyrresrkalkifksacdlverasidevfldlgricfnmlmfdneyeltgd
lklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvilal
gsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldcgkf
eitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydrsts
nidplktadlaeklfklsrgryglplssr

SCOPe Domain Coordinates for d2xgpa1:

Click to download the PDB-style file with coordinates for d2xgpa1.
(The format of our PDB-style files is described here.)

Timeline for d2xgpa1: