Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein automated matches [190099] (31 species) not a true protein |
Species Barley (Hordeum vulgare) [TaxId:4513] [255684] (11 PDB entries) |
Domain d2xgia_: 2xgi A: [244502] automated match to d1b1ya_ complexed with ebq, edo, j5b |
PDB Entry: 2xgi (more details), 1.3 Å
SCOPe Domain Sequences for d2xgia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xgia_ c.1.8.1 (A:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]} vnvkgnyvqvyvmlpldavsvnnrfekgdelraqlrklveagvdgvmvdvwwglvegkgp kaydwsaykqlfelvqkaglklqaimsfhqcggnvgdavnipipqwvrdvgtrdpdifyt dghgtrnieyltlgvdnqplfhgrsavqmyadymtsfrenmkefldagvivdievglgpa gemrypsypqshgwsfpgigeficydkylqadfkaaaaavghpewefpndvgqyndtper tqffrdngtylsekgrfflawysnnlikhgdrildeankvflgykvqlaikisgihwwyk vpshaaeltagyynlhdrdgyrtiarmlkrhrasinftcaemrdseqssqamsapeelvq qvlsagwreglnvacenalprydptayntilrnarphginqsgppehklfgftylrlsnq lvegqnyanfktfvdrmhanlprdpyvdpmaplprsgpeisiemilqaaqpklqpfpfqe htdlpvg
Timeline for d2xgia_: