![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) ![]() |
![]() | Family a.102.1.0: automated matches [191318] (1 protein) not a true family |
![]() | Protein automated matches [190108] (21 species) not a true protein |
![]() | Species Clostridium thermocellum [TaxId:1515] [255683] (6 PDB entries) |
![]() | Domain d2xfga1: 2xfg A:1-444 [244497] Other proteins in same PDB: d2xfga2 automated match to d1ia6a_ complexed with ca, cl |
PDB Entry: 2xfg (more details), 1.68 Å
SCOPe Domain Sequences for d2xfga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xfga1 a.102.1.0 (A:1-444) automated matches {Clostridium thermocellum [TaxId: 1515]} tgafnygealqkaiffyecqrsgkldsstlrlnwrgdsglddgkdagidltggwydagdh vkfnlpmsysaamlgwavyeyedafkqsgqynhilnnikwacdyfikchpekdvyyyqvg dghadhawwgpaevmpmerpsykvdrsspgstvvaetsaalaiasiifkkvdgeyskecl khakelfefadttksddgytaangfynswsgfydelswaavwlylatndssyldkaesys dkwgyepqtnipkykwaqcwddvtygtylllarikndngkykeaierhldwwttgynger itytpkglawldqwgslryatttaflacvysdwengdkekaktylefarsqadyalgstg rsfvvgfgenppkrphhrtahgswadsqmeppehrhvlygalvggpdstdnytddisnyt cnevacdynagfvgllakmyklyg
Timeline for d2xfga1: