SCOPe 2.05: Domain d2xfga_: 2xfg A:

Lineage for d2xfga_ (2xfg A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.0: automated matches [191318] (1 protein)
   not a true family

6. Protein automated matches [190108] (11 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1515] [255683] (1 PDB entry)

8. Domain d2xfga_: 2xfg A: [244497]
   automated match to d1ia6a_
   complexed with ca, cl

Details for d2xfga_

PDB Entry: 2xfg, 1.68 Å

PDB Description: reassembly and co-crystallization of a family 9 processive endoglucanase from separately expressed gh9 and cbm3c modules

PDB Compounds: (A:) endoglucanase 1

SCOPe Domain Sequences for d2xfga_:

Sequence; same for both SEQRES and ATOM records:

>d2xfga_ a.102.1.0 (A:) automated matches {Clostridium thermocellum [TaxId: 1515]}
tgafnygealqkaiffyecqrsgkldsstlrlnwrgdsglddgkdagidltggwydagdh
vkfnlpmsysaamlgwavyeyedafkqsgqynhilnnikwacdyfikchpekdvyyyqvg
dghadhawwgpaevmpmerpsykvdrsspgstvvaetsaalaiasiifkkvdgeyskecl
khakelfefadttksddgytaangfynswsgfydelswaavwlylatndssyldkaesys
dkwgyepqtnipkykwaqcwddvtygtylllarikndngkykeaierhldwwttgynger
itytpkglawldqwgslryatttaflacvysdwengdkekaktylefarsqadyalgstg
rsfvvgfgenppkrphhrtahgswadsqmeppehrhvlygalvggpdstdnytddisnyt
cnevacdynagfvgllakmyklygel

Timeline for d2xfga_:

• d2xfga_ first appeared in SCOPe 2.04
  
• d2xfga_ is called d2xfga1 in SCOPe 2.06
  
• d2xfga_ appears in the current release, SCOPe 2.08, called d2xfga1