SCOPe 2.08: Domain d2xfga1: 2xfg A:1-444

Lineage for d2xfga1 (2xfg A:1-444)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.0: automated matches [191318] (1 protein)
   not a true family

6. Protein automated matches [190108] (23 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1515] [255683] (6 PDB entries)

8. Domain d2xfga1: 2xfg A:1-444 [244497]
   Other proteins in same PDB: d2xfga2
   automated match to d1ia6a_
   complexed with ca, cl

Details for d2xfga1

PDB Entry: 2xfg, 1.68 Å

PDB Description: reassembly and co-crystallization of a family 9 processive endoglucanase from separately expressed gh9 and cbm3c modules

PDB Compounds: (A:) endoglucanase 1

SCOPe Domain Sequences for d2xfga1:

Sequence; same for both SEQRES and ATOM records:

>d2xfga1 a.102.1.0 (A:1-444) automated matches {Clostridium thermocellum [TaxId: 1515]}
tgafnygealqkaiffyecqrsgkldsstlrlnwrgdsglddgkdagidltggwydagdh
vkfnlpmsysaamlgwavyeyedafkqsgqynhilnnikwacdyfikchpekdvyyyqvg
dghadhawwgpaevmpmerpsykvdrsspgstvvaetsaalaiasiifkkvdgeyskecl
khakelfefadttksddgytaangfynswsgfydelswaavwlylatndssyldkaesys
dkwgyepqtnipkykwaqcwddvtygtylllarikndngkykeaierhldwwttgynger
itytpkglawldqwgslryatttaflacvysdwengdkekaktylefarsqadyalgstg
rsfvvgfgenppkrphhrtahgswadsqmeppehrhvlygalvggpdstdnytddisnyt
cnevacdynagfvgllakmyklyg

Timeline for d2xfga1:

• d2xfga1 first appeared in SCOPe 2.04, called d2xfga_
  
• d2xfga1 appears in SCOPe 2.07