SCOPe 2.03: Domain d1bi1a3: 1bi1 A:148-225

Lineage for d1bi1a3 (1bi1 A:148-225)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families)
   the N-terminal domains of these repressors bind DNA

5. Family b.34.1.2: FeoA-like [50041] (4 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [50043] (15 PDB entries)
   Uniprot P33120

8. Domain d1bi1a3: 1bi1 A:148-225 [24449]
   Other proteins in same PDB: d1bi1a1, d1bi1a2

Details for d1bi1a3

PDB Entry: 1bi1, 2.2 Å

PDB Description: structure of apo-and holo-diphtheria toxin repressor

PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d1bi1a3:

Sequence, based on SEQRES records:

>d1bi1a3 b.34.1.2 (A:148-225) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshn
gkdvellddlahtiriee

Sequence, based on observed residues (ATOM records):

>d1bi1a3 b.34.1.2 (A:148-225) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrhitlshngk
dvellddlahtiriee

Timeline for d1bi1a3:

• d1bi1a3 first appeared (with stable ids) in SCOP 1.55, called d1bi1_3
  
• d1bi1a3 appears in SCOPe 2.02
  
• d1bi1a3 appears in SCOPe 2.04
  
• d1bi1a3 appears in the current release, SCOPe 2.08