SCOPe 2.04: Domain d2xdfc_: 2xdf C:

Lineage for d2xdfc_ (2xdf C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (2 families)

5. Family d.94.1.1: HPr-like [55595] (3 proteins)
   automatically mapped to Pfam PF00381

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)

7. Species Escherichia coli [TaxId:562] [55599] (17 PDB entries)

8. Domain d2xdfc_: 2xdf C: [244488]
   automated match to d1poha_

Details for d2xdfc_

PDB Entry: 2xdf

PDB Description: solution structure of the enzyme i dimer complexed with hpr using residual dipolar couplings and small angle x-ray scattering

PDB Compounds: (C:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d2xdfc_:

Sequence; same for both SEQRES and ATOM records:

>d2xdfc_ d.94.1.1 (C:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli [TaxId: 562]}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

Timeline for d2xdfc_:

• d2xdfc_ is new in SCOPe 2.04-stable
  
• d2xdfc_ appears in SCOPe 2.05
  
• d2xdfc_ appears in the current release, SCOPe 2.08