Lineage for d2xdfc_ (2xdf C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965911Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2965912Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 2965913Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 2965930Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)
  7. 2965957Species Escherichia coli [TaxId:562] [55599] (23 PDB entries)
  8. 2965982Domain d2xdfc_: 2xdf C: [244488]
    automated match to d1poha_

Details for d2xdfc_

PDB Entry: 2xdf (more details)

PDB Description: solution structure of the enzyme i dimer complexed with hpr using residual dipolar couplings and small angle x-ray scattering
PDB Compounds: (C:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d2xdfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xdfc_ d.94.1.1 (C:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli [TaxId: 562]}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

SCOPe Domain Coordinates for d2xdfc_:

Click to download the PDB-style file with coordinates for d2xdfc_.
(The format of our PDB-style files is described here.)

Timeline for d2xdfc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2xdfd_