Lineage for d2xd2a_ (2xd2 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880254Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1880255Protein automated matches [190039] (120 species)
    not a true protein
  7. 1880931Species Streptococcus pneumoniae [TaxId:170187] [226722] (3 PDB entries)
  8. 1880934Domain d2xd2a_: 2xd2 A: [244485]
    automated match to d2fnca_

Details for d2xd2a_

PDB Entry: 2xd2 (more details), 2.9 Å

PDB Description: the crystal structure of malx from streptococcus pneumoniae
PDB Compounds: (A:) maltose/maltodextrin-binding protein

SCOPe Domain Sequences for d2xd2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xd2a_ c.94.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
keltvyvdegyksyieevakayekeagvkvtlktgdalggldklsldnqngnvpdvmmap
ydrvgslgsdgqlsevklsdgaktddttkslvtaangkvygapavieslvmyynkdlvkd
apktfadlenlakdskyafagedgkttafladwtnfyytygllagngayvfgqngkdakd
iglandgsivginyakswyekwpkgmqdtegagnliqtqfqegktaaiidgpwkaqafkd
akvnygvatiptlpngkeyaafgggkawvipqavknleasqkfvdflvateqqkvlydkt
neipantearsyaegkndelttavikqfkntqplpnisqmsavwdpaknmlfdavsgqkd
aktaandavtliketlkqk

SCOPe Domain Coordinates for d2xd2a_:

Click to download the PDB-style file with coordinates for d2xd2a_.
(The format of our PDB-style files is described here.)

Timeline for d2xd2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2xd2b_