Lineage for d1biba2 (1bib A:271-317)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946134Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. 946135Family b.34.1.1: Biotin repressor (BirA) [50038] (2 proteins)
  6. 946136Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species)
  7. 946137Species Escherichia coli [TaxId:562] [50040] (4 PDB entries)
  8. 946141Domain d1biba2: 1bib A:271-317 [24448]
    Other proteins in same PDB: d1biba1, d1biba3
    complexed with btn

Details for d1biba2

PDB Entry: 1bib (more details), 2.8 Å

PDB Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and dna-binding domains
PDB Compounds: (A:) bir a

SCOPe Domain Sequences for d1biba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1biba2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]}
finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr

SCOPe Domain Coordinates for d1biba2:

Click to download the PDB-style file with coordinates for d1biba2.
(The format of our PDB-style files is described here.)

Timeline for d1biba2: