![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) ![]() the N-terminal domains of these repressors bind DNA |
![]() | Family b.34.1.1: Biotin repressor (BirA) [50038] (1 protein) |
![]() | Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [50040] (3 PDB entries) |
![]() | Domain d1bib_2: 1bib 271-317 [24448] Other proteins in same PDB: d1bib_1, d1bib_3 complexed with btn |
PDB Entry: 1bib (more details), 2.8 Å
SCOP Domain Sequences for d1bib_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bib_2 b.34.1.1 (271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli} finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr
Timeline for d1bib_2: