Lineage for d1bib_2 (1bib 271-317)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 557280Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 557281Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. 557282Family b.34.1.1: Biotin repressor (BirA) [50038] (1 protein)
  6. 557283Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species)
  7. 557284Species Escherichia coli [TaxId:562] [50040] (3 PDB entries)
  8. 557288Domain d1bib_2: 1bib 271-317 [24448]
    Other proteins in same PDB: d1bib_1, d1bib_3
    complexed with btn

Details for d1bib_2

PDB Entry: 1bib (more details), 2.8 Å

PDB Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and dna-binding domains

SCOP Domain Sequences for d1bib_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bib_2 b.34.1.1 (271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli}
finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr

SCOP Domain Coordinates for d1bib_2:

Click to download the PDB-style file with coordinates for d1bib_2.
(The format of our PDB-style files is described here.)

Timeline for d1bib_2: