SCOP 1.69: Domain d1bib_2: 1bib 271-317

Lineage for d1bib_2 (1bib 271-317)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families)
   the N-terminal domains of these repressors bind DNA

5. Family b.34.1.1: Biotin repressor (BirA) [50038] (1 protein)

6. Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species)

7. Species Escherichia coli [TaxId:562] [50040] (3 PDB entries)

8. Domain d1bib_2: 1bib 271-317 [24448]
   Other proteins in same PDB: d1bib_1, d1bib_3

Details for d1bib_2

PDB Entry: 1bib, 2.8 Å

PDB Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and dna-binding domains

SCOP Domain Sequences for d1bib_2:

Sequence; same for both SEQRES and ATOM records:

>d1bib_2 b.34.1.1 (271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli}
finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr

Timeline for d1bib_2:

• d1bib_2 first appeared (with stable ids) in SCOP 1.55
  
• d1bib_2 appears in SCOP 1.67
  
• d1bib_2 appears in SCOP 1.71
  
• d1bib_2 appears in the current release, SCOPe 2.08, called d1biba2