Lineage for d1bib_2 (1bib 271-317)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.34: SH3-like barrel [50036] (7 superfamilies) 
Superfamily b.34.1: C-terminal domain of biotin and diphtheria toxin repressors [50037] (2 families) 
Family b.34.1.1: Biotin repressor (BirA) [50038] (1 protein) Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species) Species Escherichia coli [TaxId:562] [50040] (2 PDB entries) 
Domain d1bib_2: 1bib 271-317 [24448]
Other proteins in same PDB: d1bib_1, d1bib_3
Details for d1bib_2
PDB Entry: 1bib (more details), 2.8 Å
PDB Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and dna-binding domains
SCOP Domain Sequences for d1bib_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bib_2 b.34.1.1 (271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli}
finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr
SCOP Domain Coordinates for d1bib_2:
Click to download the PDB-style file with coordinates for d1bib_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bib_2:
- d1bib_2 appears in SCOP 1.57
- d1bib_2 appears in the current release, SCOPe 2.08, called d1biba2
View in 3D
