Lineage for d2x9ty1 (2x9t Y:14-356)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3020224Fold e.38: Release factor [75619] (1 superfamily)
    4 domains: (1) 3-helical bundle; (2) alpha+beta of ferredoxin-like fold (3 and 4) alpha+beta of dsRDB-like fold
  4. 3020225Superfamily e.38.1: Release factor [75620] (2 families) (S)
  5. 3020238Family e.38.1.0: automated matches [191461] (1 protein)
    not a true family
  6. 3020239Protein automated matches [190712] (3 species)
    not a true protein
  7. 3020242Species Thermus thermophilus HB8 [TaxId:300852] [255681] (2 PDB entries)
  8. 3020243Domain d2x9ty1: 2x9t Y:14-356 [244476]
    Other proteins in same PDB: d2x9ty2
    complexed with mg, zn
    complexed with mg, zn

Details for d2x9ty1

PDB Entry: 2x9t (more details), 3.1 Å

PDB Description: Structure of the 70S ribosome bound to Release Factor 2 and a substrate analog provides insights into catalysis of peptide release
PDB Compounds: (Y:) Peptide chain release factor 2

SCOPe Domain Sequences for d2x9ty1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x9ty1 e.38.1.0 (Y:14-356) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
rgyldipqketrlkelerrledpslwndpeaarkvsqeaarlrrtvdtfrslesdlqgll
elmeelpaeerealkpeleeaakkldelyhqtllnfphaeknailtiqpgaggteacdwa
emllrmytrfaerqgfqvevvdltpgpeagidyaqilvkgenaygllspeagvhrlvrps
pfdasgrrhtsfagvevipevdeevevvlkpeelridvmrasgpggqgvnttdsavrvvh
lptgitvtcqttrsqiknkelalkilkarlyelerkkreeelkalrgevrpiewgsqirs
yvldknyvkdhrtglmrhdpenvldgdlmdliwaglewkagrr

SCOPe Domain Coordinates for d2x9ty1:

Click to download the PDB-style file with coordinates for d2x9ty1.
(The format of our PDB-style files is described here.)

Timeline for d2x9ty1: