SCOP 1.75: Domain d1biaa2: 1bia A:271-317

Lineage for d1biaa2 (1bia A:271-317)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families)
   the N-terminal domains of these repressors bind DNA

5. Family b.34.1.1: Biotin repressor (BirA) [50038] (2 proteins)

6. Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species)

7. Species Escherichia coli [TaxId:562] [50040] (4 PDB entries)

8. Domain d1biaa2: 1bia A:271-317 [24447]
   Other proteins in same PDB: d1biaa1, d1biaa3

Details for d1biaa2

PDB Entry: 1bia, 2.3 Å

PDB Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and dna-binding domains

PDB Compounds: (A:) BirA BIFUNCTIONAL PROTEIN

SCOP Domain Sequences for d1biaa2:

Sequence; same for both SEQRES and ATOM records:

>d1biaa2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]}
finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr

Timeline for d1biaa2:

• d1biaa2 first appeared (with stable ids) in SCOP 1.55, called d1bia_2
  
• d1biaa2 appears in SCOP 1.73
  
• d1biaa2 appears in SCOPe 2.01
  
• d1biaa2 appears in the current release, SCOPe 2.08