Lineage for d1biaa2 (1bia A:271-317)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665028Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. 665029Family b.34.1.1: Biotin repressor (BirA) [50038] (2 proteins)
  6. 665030Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species)
  7. 665031Species Escherichia coli [TaxId:562] [50040] (4 PDB entries)
  8. 665032Domain d1biaa2: 1bia A:271-317 [24447]
    Other proteins in same PDB: d1biaa1, d1biaa3

Details for d1biaa2

PDB Entry: 1bia (more details), 2.3 Å

PDB Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and dna-binding domains
PDB Compounds: (A:) BirA BIFUNCTIONAL PROTEIN

SCOP Domain Sequences for d1biaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1biaa2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]}
finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr

SCOP Domain Coordinates for d1biaa2:

Click to download the PDB-style file with coordinates for d1biaa2.
(The format of our PDB-style files is described here.)

Timeline for d1biaa2: