Lineage for d1bia_2 (1bia 271-317)
- Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds) 
Fold b.34: SH3-like barrel [50036] (15 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) 
the N-terminal domains of these repressors bind DNA
Family b.34.1.1: Biotin repressor (BirA) [50038] (1 protein) Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species) Species Escherichia coli [TaxId:562] [50040] (3 PDB entries) 
Domain d1bia_2: 1bia 271-317 [24447]
Other proteins in same PDB: d1bia_1, d1bia_3
Details for d1bia_2
PDB Entry: 1bia (more details), 2.3 Å
PDB Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and dna-binding domains
SCOP Domain Sequences for d1bia_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bia_2 b.34.1.1 (271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli}
finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr
SCOP Domain Coordinates for d1bia_2:
Click to download the PDB-style file with coordinates for d1bia_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bia_2:
- d1bia_2 first appeared (with stable ids) in SCOP 1.55
- d1bia_2 appears in SCOP 1.69
- d1bia_2 is called d1biaa2 in SCOP 1.73
- d1bia_2 appears in the current release, SCOPe 2.08, called d1biaa2
View in 3D
